SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mvzu_ (5mvz U:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053419Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2053447Protein Interleukin-1beta [50363] (2 species)
  7. 2053448Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2286554Domain d5mvzu_: 5mvz U: [329855]
    Other proteins in same PDB: d5mvzb1, d5mvzb2, d5mvzl1, d5mvzl2
    automated match to d2i1ba_
    complexed with gol

Details for d5mvzu_

PDB Entry: 5mvz (more details), 2.15 Å

PDB Description: fab 4ab007 bound to interleukin-1-beta
PDB Compounds: (U:) interleukin-1 beta

SCOPe Domain Sequences for d5mvzu_:

Sequence, based on SEQRES records: (download)

>d5mvzu_ b.42.1.2 (U:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvs

Sequence, based on observed residues (ATOM records): (download)

>d5mvzu_ b.42.1.2 (U:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsslvmsgpyelkalhleqqvvfsmsfvqgeesndkipvalglkeknlyls
cvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyistsqaenm
pvflgditdftmqfvs

SCOPe Domain Coordinates for d5mvzu_:

Click to download the PDB-style file with coordinates for d5mvzu_.
(The format of our PDB-style files is described here.)

Timeline for d5mvzu_:

  • d5mvzu_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16