Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5mp6p_: 5mp6 P: [410394] Other proteins in same PDB: d5mp6l2, d5mp6q2 automated match to d6shgh_ complexed with so4 |
PDB Entry: 5mp6 (more details), 1.96 Å
SCOPe Domain Sequences for d5mp6p_:
Sequence, based on SEQRES records: (download)
>d5mp6p_ b.1.1.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlqqsgpglvkpsqtlsltcnvygvaisnedyywtwirqhpgkglewigdiyynsgtt hynpslksrasvsvdlsrnqftlkvtsvttadaavyycareastkitddggafdfwgrgt mvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
>d5mp6p_ b.1.1.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlqqsgpglvkpsqtlsltcnvygvaisnedyywtwirqhpgkglewigdiyynsgtt hynpslksrasvsvdlsrnqftlkvtsvttadaavyycareastkitddggafdfwgrgt mvtvssastkgpsvfplapclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss vvtvpssslgtqtyicnvnhkpsntkvdkkv
Timeline for d5mp6p_: