Lineage for d5mp6p_ (5mp6 P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755833Domain d5mp6p_: 5mp6 P: [410394]
    Other proteins in same PDB: d5mp6l2, d5mp6q2
    automated match to d6shgh_
    complexed with so4

Details for d5mp6p_

PDB Entry: 5mp6 (more details), 1.96 Å

PDB Description: structure of the unliganded fab from hiv-1 neutralizing antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface, at two angstrom resolution.
PDB Compounds: (P:) CAP248-2B Heavy Chain

SCOPe Domain Sequences for d5mp6p_:

Sequence, based on SEQRES records: (download)

>d5mp6p_ b.1.1.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqsgpglvkpsqtlsltcnvygvaisnedyywtwirqhpgkglewigdiyynsgtt
hynpslksrasvsvdlsrnqftlkvtsvttadaavyycareastkitddggafdfwgrgt
mvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Sequence, based on observed residues (ATOM records): (download)

>d5mp6p_ b.1.1.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlqqsgpglvkpsqtlsltcnvygvaisnedyywtwirqhpgkglewigdiyynsgtt
hynpslksrasvsvdlsrnqftlkvtsvttadaavyycareastkitddggafdfwgrgt
mvtvssastkgpsvfplapclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkv

SCOPe Domain Coordinates for d5mp6p_:

Click to download the PDB-style file with coordinates for d5mp6p_.
(The format of our PDB-style files is described here.)

Timeline for d5mp6p_:

  • d5mp6p_ is new in SCOPe 2.08-stable