SCOPe 2.08: Domain d5mp6l1: 5mp6 L:1-108

Lineage for d5mp6l1 (5mp6 L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5mp6l1: 5mp6 L:1-108 [327707]
   Other proteins in same PDB: d5mp6l2, d5mp6q2
   automated match to d2mcg11
   complexed with so4

Details for d5mp6l1

PDB Entry: 5mp6, 1.96 Å

PDB Description: structure of the unliganded fab from hiv-1 neutralizing antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface, at two angstrom resolution.

PDB Compounds: (L:) CAP248-2B Light Chain

SCOPe Domain Sequences for d5mp6l1:

Sequence; same for both SEQRES and ATOM records:

>d5mp6l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esaltqpasvsgspgqsisisctgtssdiggykyvswyqqhpgrapkliiydvikrpsgi
sdrfsgsksantasltisglqagdeasyycssyttkktsffgpatrayvfgsgtqvtvlg

Timeline for d5mp6l1:

• d5mp6l1 first appeared in SCOPe 2.06
  
• d5mp6l1 appears in SCOPe 2.07