Lineage for d5mp6q1 (5mp6 Q:1-108)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (877 PDB entries)
  8. 2284413Domain d5mp6q1: 5mp6 Q:1-108 [327714]
    Other proteins in same PDB: d5mp6l2, d5mp6q2
    automated match to d2mcg11
    complexed with so4

Details for d5mp6q1

PDB Entry: 5mp6 (more details), 1.96 Å

PDB Description: structure of the unliganded fab from hiv-1 neutralizing antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface, at two angstrom resolution.
PDB Compounds: (Q:) CAP248-2B Light Chain

SCOPe Domain Sequences for d5mp6q1:

Sequence, based on SEQRES records: (download)

>d5mp6q1 b.1.1.0 (Q:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esaltqpasvsgspgqsisisctgtssdiggykyvswyqqhpgrapkliiydvikrpsgi
sdrfsgsksantasltisglqagdeasyycssyttkktsffgpatrayvfgsgtqvtvlg

Sequence, based on observed residues (ATOM records): (download)

>d5mp6q1 b.1.1.0 (Q:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esaltqpasvsgspgqsisisctgtssdiggykyvswyqqhpgrapkliiydvikrpsgi
sdrfsgsksantasltisglqagdeasyycssyttrayvfgsgtqvtvlg

SCOPe Domain Coordinates for d5mp6q1:

Click to download the PDB-style file with coordinates for d5mp6q1.
(The format of our PDB-style files is described here.)

Timeline for d5mp6q1:

  • d5mp6q1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5mp6q2