Lineage for d3hi6x_ (3hi6 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743009Domain d3hi6x_: 3hi6 X: [408391]
    Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6l1, d3hi6l2, d3hi6y1, d3hi6y2
    automated match to d6shgh_
    complexed with mn, so4

Details for d3hi6x_

PDB Entry: 3hi6 (more details), 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57
PDB Compounds: (X:) Heavy chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6x_:

Sequence, based on SEQRES records: (download)

>d3hi6x_ b.1.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsryvmwwvrqapgkglewvsyiwpsggntyy
adsvkgrftisrdnskntlylqmnslraedtavyycassydfwsnafdiwgqgtmvtvss
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves

Sequence, based on observed residues (ATOM records): (download)

>d3hi6x_ b.1.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsryvmwwvrqapgkglewvsyiwpsggntyy
adsvkgrftisrdnskntlylqmnslraedtavyycassydfwsnafdiwgqgtmvtvss
astkgpsvfplapstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtktytcnvdhkpsntkvdkrves

SCOPe Domain Coordinates for d3hi6x_:

Click to download the PDB-style file with coordinates for d3hi6x_.
(The format of our PDB-style files is described here.)

Timeline for d3hi6x_:

  • d3hi6x_ is new in SCOPe 2.08-stable