SCOPe 2.08: Domain d3hi6y2: 3hi6 Y:107-210

Lineage for d3hi6y2 (3hi6 Y:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3hi6y2: 3hi6 Y:107-210 [199514]
   Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6h_, d3hi6l1, d3hi6x_, d3hi6y1
   automated match to d3fcta2
   complexed with mn, so4

Details for d3hi6y2

PDB Entry: 3hi6, 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57

PDB Compounds: (Y:) light chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6y2:

Sequence; same for both SEQRES and ATOM records:

>d3hi6y2 b.1.1.2 (Y:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3hi6y2:

• d3hi6y2 first appeared in SCOPe 2.03
  
• d3hi6y2 appears in SCOPe 2.07