PDB entry 3hi6

View 3hi6 on RCSB PDB site
Description: Crystal structure of intermediate affinity I domain of integrin LFA-1 with the Fab fragment of its antibody AL-57
Class: cell adhesion/immune system
Keywords: integrin, I domain, Fab, ligand mimetic antibody, cell adhesion, Alternative splicing, Calcium, Disulfide bond, Glycoprotein, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane, cell adhesion-immune system COMPLEX
Deposited on 2009-05-19, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11A, ITGAL, LFA-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-179)
      • engineered (33)
      • variant (61)
      • engineered (171)
    Domains in SCOPe 2.07: d3hi6a_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: CD11A, ITGAL, LFA-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (0-179)
      • engineered (33)
      • variant (61)
      • engineered (171)
    Domains in SCOPe 2.07: d3hi6b_
  • Chain 'H':
    Compound: Heavy chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI6 (0-219)
  • Chain 'L':
    Compound: light chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI6 (Start-211)
    Domains in SCOPe 2.07: d3hi6l1, d3hi6l2
  • Chain 'X':
    Compound: Heavy chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI6 (0-219)
  • Chain 'Y':
    Compound: light chain of Fab fragment of AL-57 against alpha L I domain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3HI6
    Domains in SCOPe 2.07: d3hi6y1, d3hi6y2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hi6A (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkkiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hi6B (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkkiy
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3hi6L (L:)
    qdiqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvp
    srfsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi6L (L:)
    iqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvpsr
    fsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3hi6Y (Y:)
    qdiqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvp
    srfsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hi6Y (Y:)
    iqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvpsr
    fsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnr