Lineage for d3hi6a_ (3hi6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892349Protein automated matches [190060] (2 species)
    not a true protein
  7. 2892352Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)
  8. 2892371Domain d3hi6a_: 3hi6 A: [177600]
    Other proteins in same PDB: d3hi6h_, d3hi6l1, d3hi6l2, d3hi6x_, d3hi6y1, d3hi6y2
    automated match to d1cqpa_
    complexed with mn, so4

Details for d3hi6a_

PDB Entry: 3hi6 (more details), 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57
PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d3hi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hi6a_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkkiy

SCOPe Domain Coordinates for d3hi6a_:

Click to download the PDB-style file with coordinates for d3hi6a_.
(The format of our PDB-style files is described here.)

Timeline for d3hi6a_: