Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein Angiotensin converting enzyme 2, ACE2 [103125] (3 species) |
Species Cat (Felis catus) [TaxId:9685] [389846] (1 PDB entry) |
Domain d7c8da_: 7c8d A: [389847] Other proteins in same PDB: d7c8db_ automated match to d3scia_ complexed with zn |
PDB Entry: 7c8d (more details), 3 Å
SCOPe Domain Sequences for d7c8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c8da_ d.92.1.5 (A:) Angiotensin converting enzyme 2, ACE2 {Cat (Felis catus) [TaxId: 9685]} qstteelaktflekfnheaeelsyqsslaswnyntnitdenvqkmneagakwsafyeeqs klaktyplaeihnttvkrqlqalqqsgssvlsadksqrlntilnamstiystgkacnpnn pqeclllepglddimenskdynerlwawegwraevgkqlrplyeeyvalknemarannye dygdywrgdyeeewtdgynysrsqlikdvehtftqikplyqhlhayvraklmdtypsris ptgclpahllgdmwgrfwtnlypltvpfgqkpnidvtdamvnqswdarrifkeaekffvs vglpnmtqgfwensmltepgdsrkvvchptawdlgkgdfrikmctkvtmddfltahhemg hiqydmayavqpfllrnganegfheavgeimslsaatpnhlktigllspgfsedsetein fllkqaltivgtlpftymlekwrwmvfkgeipkeqwmqkwwemkreivgvvepvphdety cdpaslfhvandysfiryytrtiyqfqfqealcriakhegplhkcdisnsseagkkllqm ltlgkskpwtlalehvvgekkmnvtpllkyfeplftwlkeqnrnsfvgwntdwrpya
Timeline for d7c8da_: