Lineage for d7c8da_ (7c8d A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529230Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 2529231Protein Angiotensin converting enzyme 2, ACE2 [103125] (2 species)
  7. 3089784Species Felis catus [TaxId:9685] [389846] (1 PDB entry)
  8. 3089785Domain d7c8da_: 7c8d A: [389847]
    Other proteins in same PDB: d7c8db_
    automated match to d3scia_
    complexed with zn

Details for d7c8da_

PDB Entry: 7c8d (more details), 3 Å

PDB Description: cryo-em structure of cat ace2 and sars-cov-2 rbd
PDB Compounds: (A:) Angiotensin-converting enzyme 2

SCOPe Domain Sequences for d7c8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c8da_ d.92.1.5 (A:) Angiotensin converting enzyme 2, ACE2 {Felis catus [TaxId: 9685]}
qstteelaktflekfnheaeelsyqsslaswnyntnitdenvqkmneagakwsafyeeqs
klaktyplaeihnttvkrqlqalqqsgssvlsadksqrlntilnamstiystgkacnpnn
pqeclllepglddimenskdynerlwawegwraevgkqlrplyeeyvalknemarannye
dygdywrgdyeeewtdgynysrsqlikdvehtftqikplyqhlhayvraklmdtypsris
ptgclpahllgdmwgrfwtnlypltvpfgqkpnidvtdamvnqswdarrifkeaekffvs
vglpnmtqgfwensmltepgdsrkvvchptawdlgkgdfrikmctkvtmddfltahhemg
hiqydmayavqpfllrnganegfheavgeimslsaatpnhlktigllspgfsedsetein
fllkqaltivgtlpftymlekwrwmvfkgeipkeqwmqkwwemkreivgvvepvphdety
cdpaslfhvandysfiryytrtiyqfqfqealcriakhegplhkcdisnsseagkkllqm
ltlgkskpwtlalehvvgekkmnvtpllkyfeplftwlkeqnrnsfvgwntdwrpya

SCOPe Domain Coordinates for d7c8da_:

Click to download the PDB-style file with coordinates for d7c8da_.
(The format of our PDB-style files is described here.)

Timeline for d7c8da_:

  • d7c8da_ is new in SCOPe 2.07-stable