Lineage for d6u7ja2 (6u7j A:196-284)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763278Species Uncultured clostridium [TaxId:59620] [376292] (1 PDB entry)
  8. 2763279Domain d6u7ja2: 6u7j A:196-284 [376298]
    Other proteins in same PDB: d6u7ja1, d6u7ja3, d6u7ja4, d6u7jb1, d6u7jb3, d6u7jb4, d6u7jc1, d6u7jc3, d6u7jc4, d6u7jd1, d6u7jd3, d6u7jd4
    automated match to d5c71a2
    complexed with ca

Details for d6u7ja2

PDB Entry: 6u7j (more details), 2.2 Å

PDB Description: uncultured clostridium sp. beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6u7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7ja2 b.1.4.0 (A:196-284) automated matches {Uncultured clostridium [TaxId: 59620]}
eyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaq
lwqpgsaylykldiyfgqdhytlpfgirt

SCOPe Domain Coordinates for d6u7ja2:

Click to download the PDB-style file with coordinates for d6u7ja2.
(The format of our PDB-style files is described here.)

Timeline for d6u7ja2: