Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Uncultured clostridium [TaxId:59620] [376292] (1 PDB entry) |
Domain d6u7ja2: 6u7j A:196-284 [376298] Other proteins in same PDB: d6u7ja1, d6u7ja3, d6u7ja4, d6u7jb1, d6u7jb3, d6u7jb4, d6u7jc1, d6u7jc3, d6u7jc4, d6u7jd1, d6u7jd3, d6u7jd4 automated match to d5c71a2 complexed with ca |
PDB Entry: 6u7j (more details), 2.2 Å
SCOPe Domain Sequences for d6u7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7ja2 b.1.4.0 (A:196-284) automated matches {Uncultured clostridium [TaxId: 59620]} eyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaq lwqpgsaylykldiyfgqdhytlpfgirt
Timeline for d6u7ja2: