PDB entry 6u7j

View 6u7j on RCSB PDB site
Description: Uncultured Clostridium sp. Beta-glucuronidase
Class: hydrolase
Keywords: microbiome, Glycosyl hydrolase, HYDROLASE
Deposited on 2019-09-03, released 2019-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: uncultured Clostridium sp. [TaxId:59620]
    Gene: uidA_2, SAMEA3545339_03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1C5YG41 (9-End)
      • expression tag (8)
      • conflict (20)
      • conflict (225)
      • conflict (231)
      • conflict (454)
    Domains in SCOPe 2.07: d6u7ja1, d6u7ja2, d6u7ja3, d6u7ja4
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: uncultured Clostridium sp. [TaxId:59620]
    Gene: uidA_2, SAMEA3545339_03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1C5YG41 (9-End)
      • expression tag (7-8)
      • conflict (20)
      • conflict (225)
      • conflict (231)
      • conflict (454)
    Domains in SCOPe 2.07: d6u7jb1, d6u7jb2, d6u7jb3, d6u7jb4
  • Chain 'C':
    Compound: beta-glucuronidase
    Species: uncultured Clostridium sp. [TaxId:59620]
    Gene: uidA_2, SAMEA3545339_03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1C5YG41 (9-End)
      • expression tag (8)
      • conflict (20)
      • conflict (225)
      • conflict (231)
      • conflict (454)
    Domains in SCOPe 2.07: d6u7jc1, d6u7jc2, d6u7jc3, d6u7jc4
  • Chain 'D':
    Compound: beta-glucuronidase
    Species: uncultured Clostridium sp. [TaxId:59620]
    Gene: uidA_2, SAMEA3545339_03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1C5YG41 (9-End)
      • expression tag (8)
      • conflict (20)
      • conflict (225)
      • conflict (231)
      • conflict (454)
    Domains in SCOPe 2.07: d6u7jd1, d6u7jd2, d6u7jd3, d6u7jd4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u7jA (A:)
    mmpgkrrfdmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpss
    yndittdqelrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkgg
    flpfeadvtemanegenrltvavgnilewdclpvghieyvrdemhpegqmeqkfdfdffn
    ysgihrpvrlyctpkeyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvva
    esnemkdmvlvkdaqlwqpgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfy
    fkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypyaeemmqmadqkgivvi
    devpavgmnffdgenggiftedkvnektlayhkqvlkelyqrdknhpcvvmwsitnephs
    seeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdvvcinryfgwyvgagki
    eriypslktdlikwhekygkpvivteygadtiaglhklpevifseeyqkrcieennkamd
    ecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaafairerwrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u7jA (A:)
    dmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittdq
    elrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfeadv
    temanegenrltvavgnilewdclpvghieymeqkfdfdffnysgihrpvrlyctpkeyi
    edisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaqlwq
    pgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfyfkgfgkhedsdirgkgld
    ealnvrdcellkwigansfrtshypyaeemmqmadqkgivvidevpavgmnfgiftedkv
    nektlayhkqvlkelyqrdknhpcvvmwsitnephsseeasrnyfeevtkyirkldserp
    itgtmnvdveedkisqffdvvcinryfgwyvgagkieriypslktdlikwhekygkpviv
    teygadtiaglhklpevifseeyqkrcieennkamdecdfvigehiwafadfmtafglkr
    vdgnkkgiftrerqpktaafairerwrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u7jB (B:)
    mmpgkrrfdmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpss
    yndittdqelrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkgg
    flpfeadvtemanegenrltvavgnilewdclpvghieyvrdemhpegqmeqkfdfdffn
    ysgihrpvrlyctpkeyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvva
    esnemkdmvlvkdaqlwqpgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfy
    fkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypyaeemmqmadqkgivvi
    devpavgmnffdgenggiftedkvnektlayhkqvlkelyqrdknhpcvvmwsitnephs
    seeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdvvcinryfgwyvgagki
    eriypslktdlikwhekygkpvivteygadtiaglhklpevifseeyqkrcieennkamd
    ecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaafairerwrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u7jB (B:)
    fdmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittd
    qelrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfead
    vtemanegenrltvavgnilewdclpvghieymeqkfdfdffnysgihrpvrlyctpkey
    iedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaqlw
    qpgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfyfkgfgkhedsdirgkgl
    dealnvrdcellkwigansfrtshypyaeemmqmadqkgivvidevpavgmnfgiftedk
    vnektlayhkqvlkelyqrdknhpcvvmwsitnephsseeasrnyfeevtkyirkldser
    pitgtmnvdveedkisqffdvvcinryfgwyvgagkieriypslktdlikwhekygkpvi
    vteygadtiaglhklpevifseeyqkrcieennkamdecdfvigehiwafadfmtafglk
    rvdgnkkgiftrerqpktaafairerwrkm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u7jC (C:)
    mmpgkrrfdmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpss
    yndittdqelrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkgg
    flpfeadvtemanegenrltvavgnilewdclpvghieyvrdemhpegqmeqkfdfdffn
    ysgihrpvrlyctpkeyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvva
    esnemkdmvlvkdaqlwqpgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfy
    fkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypyaeemmqmadqkgivvi
    devpavgmnffdgenggiftedkvnektlayhkqvlkelyqrdknhpcvvmwsitnephs
    seeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdvvcinryfgwyvgagki
    eriypslktdlikwhekygkpvivteygadtiaglhklpevifseeyqkrcieennkamd
    ecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaafairerwrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u7jC (C:)
    dmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittdq
    elrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfeadv
    temanegenrltvavgnilewdclpvghieymeqkfdfdffnysgihrpvrlyctpkeyi
    edisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaqlwq
    pgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfyfkgfgkhedsdirgkgld
    ealnvrdcellkwigansfrtshypyaeemmqmadqkgivvidevpavgmnfgiftedkv
    nektlayhkqvlkelyqrdknhpcvvmwsitnephsseeasrnyfeevtkyirkldserp
    itgtmnvdveedkisqffdvvcinryfgwyvgagkieriypslktdlikwhekygkpviv
    teygadtiaglhklpevifseeyqkrcieennkamdecdfvigehiwafadfmtafglkr
    vdgnkkgiftrerqpktaafairerwrkm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6u7jD (D:)
    mmpgkrrfdmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpss
    yndittdqelrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkgg
    flpfeadvtemanegenrltvavgnilewdclpvghieyvrdemhpegqmeqkfdfdffn
    ysgihrpvrlyctpkeyiedisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvva
    esnemkdmvlvkdaqlwqpgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfy
    fkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypyaeemmqmadqkgivvi
    devpavgmnffdgenggiftedkvnektlayhkqvlkelyqrdknhpcvvmwsitnephs
    seeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdvvcinryfgwyvgagki
    eriypslktdlikwhekygkpvivteygadtiaglhklpevifseeyqkrcieennkamd
    ecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaafairerwrkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u7jD (D:)
    dmlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittdq
    elrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfeadv
    temanegenrltvavgnilewdclpvghieymeqkfdfdffnysgihrpvrlyctpkeyi
    edisvrttvddkdgmvhyeiktnaeekfikvyirdeknqvvaesnemkdmvlvkdaqlwq
    pgsaylykldiyfgqdhytlpfgirtiqltekqflingkpfyfkgfgkhedsdirgkgld
    ealnvrdcellkwigansfrtshypyaeemmqmadqkgivvidevpavgmnfgiftedkv
    nektlayhkqvlkelyqrdknhpcvvmwsitnephsseeasrnyfeevtkyirkldserp
    itgtmnvdveedkisqffdvvcinryfgwyvgagkieriypslktdlikwhekygkpviv
    teygadtiaglhklpevifseeyqkrcieennkamdecdfvigehiwafadfmtafglkr
    vdgnkkgiftrerqpktaafairerwrkm