Lineage for d6u7jd3 (6u7j D:285-593)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (111 species)
    not a true protein
  7. 3076232Species Uncultured clostridium [TaxId:59620] [376294] (1 PDB entry)
  8. 3076233Domain d6u7jd3: 6u7j D:285-593 [376295]
    Other proteins in same PDB: d6u7ja1, d6u7ja2, d6u7ja4, d6u7jb1, d6u7jb2, d6u7jb4, d6u7jc1, d6u7jc2, d6u7jc4, d6u7jd1, d6u7jd2, d6u7jd4
    automated match to d5c70a3
    complexed with ca

Details for d6u7jd3

PDB Entry: 6u7j (more details), 2.2 Å

PDB Description: uncultured clostridium sp. beta-glucuronidase
PDB Compounds: (D:) beta-glucuronidase

SCOPe Domain Sequences for d6u7jd3:

Sequence, based on SEQRES records: (download)

>d6u7jd3 c.1.8.0 (D:285-593) automated matches {Uncultured clostridium [TaxId: 59620]}
iqltekqflingkpfyfkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypy
aeemmqmadqkgivvidevpavgmnffdgenggiftedkvnektlayhkqvlkelyqrdk
nhpcvvmwsitnephsseeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdv
vcinryfgwyvgagkieriypslktdlikwhekygkpvivteygadtiaglhklpevifs
eeyqkrcieennkamdecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaaf
airerwrkm

Sequence, based on observed residues (ATOM records): (download)

>d6u7jd3 c.1.8.0 (D:285-593) automated matches {Uncultured clostridium [TaxId: 59620]}
iqltekqflingkpfyfkgfgkhedsdirgkgldealnvrdcellkwigansfrtshypy
aeemmqmadqkgivvidevpavgmnfgiftedkvnektlayhkqvlkelyqrdknhpcvv
mwsitnephsseeasrnyfeevtkyirkldserpitgtmnvdveedkisqffdvvcinry
fgwyvgagkieriypslktdlikwhekygkpvivteygadtiaglhklpevifseeyqkr
cieennkamdecdfvigehiwafadfmtafglkrvdgnkkgiftrerqpktaafairerw
rkm

SCOPe Domain Coordinates for d6u7jd3:

Click to download the PDB-style file with coordinates for d6u7jd3.
(The format of our PDB-style files is described here.)

Timeline for d6u7jd3: