Lineage for d6u7ja1 (6u7j A:10-195)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (45 species)
    not a true protein
  7. 3076228Species Uncultured clostridium [TaxId:59620] [376290] (1 PDB entry)
  8. 3076235Domain d6u7ja1: 6u7j A:10-195 [376297]
    Other proteins in same PDB: d6u7ja2, d6u7ja3, d6u7ja4, d6u7jb2, d6u7jb3, d6u7jb4, d6u7jc2, d6u7jc3, d6u7jc4, d6u7jd2, d6u7jd3, d6u7jd4
    automated match to d5c70a1
    complexed with ca

Details for d6u7ja1

PDB Entry: 6u7j (more details), 2.2 Å

PDB Description: uncultured clostridium sp. beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6u7ja1:

Sequence, based on SEQRES records: (download)

>d6u7ja1 b.18.1.0 (A:10-195) automated matches {Uncultured clostridium [TaxId: 59620]}
mlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittdqe
lrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfeadvt
emanegenrltvavgnilewdclpvghieyvrdemhpegqmeqkfdfdffnysgihrpvr
lyctpk

Sequence, based on observed residues (ATOM records): (download)

>d6u7ja1 b.18.1.0 (A:10-195) automated matches {Uncultured clostridium [TaxId: 59620]}
mlfpvdnearqikelngiwkfkrdnyykqgfeekwfekpledvidmpvpssyndittdqe
lrdhvgwvwyerkfavprlwkdqrlvlrfgsvthhaviylngkeitrhkggflpfeadvt
emanegenrltvavgnilewdclpvghieymeqkfdfdffnysgihrpvrlyctpk

SCOPe Domain Coordinates for d6u7ja1:

Click to download the PDB-style file with coordinates for d6u7ja1.
(The format of our PDB-style files is described here.)

Timeline for d6u7ja1: