![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries) |
![]() | Domain d6jlld_: 6jll D: [375533] Other proteins in same PDB: d6jllb_, d6jllc_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d5zznd_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jlld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlld_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef etfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d6jlld_: