Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) automatically mapped to Pfam PF02533 |
Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries) |
Domain d6jllk_: 6jll k: [390219] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllk_ f.23.36.1 (k:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d6jllk_: