Lineage for d6jlli_ (6jll I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026719Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 3026735Domain d6jlli_: 6jll I: [390211]
    Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jlle_, d6jllf_, d6jllh_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlli_

PDB Entry: 6jll (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset1)
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d6jlli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlli_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d6jlli_:

Click to download the PDB-style file with coordinates for d6jlli_.
(The format of our PDB-style files is described here.)

Timeline for d6jlli_: