SCOPe 2.08: Domain d6jllo_: 6jll o:

Lineage for d6jllo_ (6jll o:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.4: PsbO-like [161115] (2 proteins)
   Pfam PF01716; MSP

6. Protein Manganese-stabilising protein, PsbO [161116] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries)

8. Domain d6jllo_: 6jll o: [390224]
   Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_
   automated match to d4il6o_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jllo_

PDB Entry: 6jll, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset1)

PDB Compounds: (o:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d6jllo_:

Sequence; same for both SEQRES and ATOM records:

>d6jllo_ f.4.1.4 (o:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

Timeline for d6jllo_:

• d6jllo_ first appeared in SCOPe 2.07