Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries) |
Domain d6jllo_: 6jll o: [390224] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllm_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d4il6o_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllo_ f.4.1.4 (o:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]} tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi epa
Timeline for d6jllo_: