Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries) |
Domain d6jllm_: 6jll M: [390230] Other proteins in same PDB: d6jlla_, d6jllb_, d6jllc_, d6jlld_, d6jlle_, d6jllf_, d6jllh_, d6jlli_, d6jllj_, d6jllk_, d6jlll_, d6jllo_, d6jllt_, d6jllu_, d6jllv_, d6jllx_, d6jllz_ automated match to d2axtm1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jll (more details), 2.15 Å
SCOPe Domain Sequences for d6jllm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jllm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d6jllm_: