SCOPe 2.08: Domain d6jlpd_: 6jlp d:

Lineage for d6jlpd_ (6jlp d:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)

8. Domain d6jlpd_: 6jlp d: [375425]
   Other proteins in same PDB: d6jlpb_, d6jlpc_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_
   automated match to d5zznd_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpd_

PDB Entry: 6jlp, 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)

PDB Compounds: (d:) Photosystem II D2 protein

SCOPe Domain Sequences for d6jlpd_:

Sequence; same for both SEQRES and ATOM records:

>d6jlpd_ f.26.1.1 (d:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d6jlpd_:

• d6jlpd_ first appeared in SCOPe 2.07