Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) automatically mapped to Pfam PF01405 |
Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries) |
Domain d6jlpt_: 6jlp t: [375432] Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlp (more details), 2.5 Å
SCOPe Domain Sequences for d6jlpt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlpt_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
Timeline for d6jlpt_: