Lineage for d6jlpu_ (6jlp u:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716634Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2716639Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2716658Domain d6jlpu_: 6jlp u: [375415]
    Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpv_, d6jlpx_, d6jlpz_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpu_

PDB Entry: 6jlp (more details), 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d6jlpu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlpu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d6jlpu_:

Click to download the PDB-style file with coordinates for d6jlpu_.
(The format of our PDB-style files is described here.)

Timeline for d6jlpu_: