Lineage for d6jlpi_ (6jlp I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026719Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 3026740Domain d6jlpi_: 6jlp I: [375408]
    Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpo_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlpi_

PDB Entry: 6jlp (more details), 2.5 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (3f state, dataset2)
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d6jlpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlpi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d6jlpi_:

Click to download the PDB-style file with coordinates for d6jlpi_.
(The format of our PDB-style files is described here.)

Timeline for d6jlpi_: