![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
![]() | Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries) |
![]() | Domain d6jlpo_: 6jlp o: [375471] Other proteins in same PDB: d6jlpa_, d6jlpb_, d6jlpc_, d6jlpd_, d6jlpe_, d6jlpf_, d6jlph_, d6jlpi_, d6jlpj_, d6jlpk_, d6jlpl_, d6jlpm_, d6jlpt_, d6jlpu_, d6jlpv_, d6jlpx_, d6jlpz_ automated match to d4il6o_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jlp (more details), 2.5 Å
SCOPe Domain Sequences for d6jlpo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlpo_ f.4.1.4 (o:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]} tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi epa
Timeline for d6jlpo_: