![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
![]() | Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
![]() | Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries) |
![]() | Domain d6jlkh_: 6jlk H: [375392] Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_ automated match to d5v2ch_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlk (more details), 2.15 Å
SCOPe Domain Sequences for d6jlkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlkh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wkalg
Timeline for d6jlkh_: