![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
![]() | Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) ![]() automatically mapped to Pfam PF00421 |
![]() | Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
![]() | Protein automated matches [191285] (5 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries) |
![]() | Domain d6jlkc_: 6jlk C: [375422] Other proteins in same PDB: d6jlka_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_ automated match to d5b66c_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlk (more details), 2.15 Å
SCOPe Domain Sequences for d6jlkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlkc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl whagraraaaagfekgidresepvlsmpsld
Timeline for d6jlkc_: