Lineage for d6jlkh_ (6jlk H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631824Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2631834Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)
  8. 2631843Domain d6jlkh_: 6jlk H: [375392]
    Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_
    automated match to d5v2ch_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlkh_

PDB Entry: 6jlk (more details), 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d6jlkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlkh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d6jlkh_:

Click to download the PDB-style file with coordinates for d6jlkh_.
(The format of our PDB-style files is described here.)

Timeline for d6jlkh_: