![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
![]() | Family f.23.40.1: PsbX-like [267615] (2 proteins) |
![]() | Protein automated matches [267680] (2 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries) |
![]() | Domain d6jlkx_: 6jlk X: [375416] Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkz_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlk (more details), 2.15 Å
SCOPe Domain Sequences for d6jlkx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlkx_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqidkvqrs
Timeline for d6jlkx_: