SCOPe 2.08: Domain d6jlku_: 6jlk U:

Lineage for d6jlku_ (6jlk U:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)

8. Domain d6jlku_: 6jlk U: [375424]
   Other proteins in same PDB: d6jlka_, d6jlkb_, d6jlkc_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlkv_, d6jlkx_, d6jlkz_
   automated match to d2axtu1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlku_

PDB Entry: 6jlk, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d6jlku_:

Sequence; same for both SEQRES and ATOM records:

>d6jlku_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d6jlku_:

• d6jlku_ first appeared in SCOPe 2.07