Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (17 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries) |
Domain d6jlka_: 6jlk A: [375393] Other proteins in same PDB: d6jlkb_, d6jlkc_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_ automated match to d2axta1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 6jlk (more details), 2.15 Å
SCOPe Domain Sequences for d6jlka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlka_ f.26.1.1 (A:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva ahgyfgrlifqyasfnnsrslhfflaawpvvgvwfaalgistmafnlngfnfnhsvidak gnvintwadiinranlgmevmhernahnfpldla
Timeline for d6jlka_: