Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d6ev1h2: 6ev1 H:107-211 [358025] Other proteins in same PDB: d6ev1a_, d6ev1b1, d6ev1c_, d6ev1d1, d6ev1e_, d6ev1f1, d6ev1g_, d6ev1h1, d6ev1i_, d6ev1j1, d6ev1k_, d6ev1l1 automated match to d1n0xl2 |
PDB Entry: 6ev1 (more details), 3.04 Å
SCOPe Domain Sequences for d6ev1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ev1h2 b.1.1.2 (H:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg
Timeline for d6ev1h2: