Lineage for d6ev1h2 (6ev1 H:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753312Domain d6ev1h2: 6ev1 H:107-211 [358025]
    Other proteins in same PDB: d6ev1a_, d6ev1b1, d6ev1c_, d6ev1d1, d6ev1e_, d6ev1f1, d6ev1g_, d6ev1h1, d6ev1i_, d6ev1j1, d6ev1k_, d6ev1l1
    automated match to d1n0xl2

Details for d6ev1h2

PDB Entry: 6ev1 (more details), 3.04 Å

PDB Description: crystal structure of antibody against schizophyllan
PDB Compounds: (H:) light chain

SCOPe Domain Sequences for d6ev1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ev1h2 b.1.1.2 (H:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

SCOPe Domain Coordinates for d6ev1h2:

Click to download the PDB-style file with coordinates for d6ev1h2.
(The format of our PDB-style files is described here.)

Timeline for d6ev1h2: