SCOPe 2.08: Domain d6ev1l2: 6ev1 L:107-211

Lineage for d6ev1l2 (6ev1 L:107-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d6ev1l2: 6ev1 L:107-211 [358163]
Other proteins in same PDB: d6ev1a_, d6ev1b1, d6ev1c_, d6ev1d1, d6ev1e_, d6ev1f1, d6ev1g_, d6ev1h1, d6ev1i_, d6ev1j1, d6ev1k_, d6ev1l1
automated match to d1n0xl2

Details for d6ev1l2

PDB Entry: 6ev1 (more details), 3.04 Å

PDB Description: crystal structure of antibody against schizophyllan

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6ev1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ev1l2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

SCOPe Domain Coordinates for d6ev1l2:

Click to download the PDB-style file with coordinates for d6ev1l2.
(The format of our PDB-style files is described here.)

Timeline for d6ev1l2: