Lineage for d6ev1b2 (6ev1 B:107-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 3057990Domain d6ev1b2: 6ev1 B:107-210 [358052]
    Other proteins in same PDB: d6ev1b1, d6ev1d1, d6ev1f1, d6ev1h1, d6ev1j1, d6ev1l1
    automated match to d1n0xl2

Details for d6ev1b2

PDB Entry: 6ev1 (more details), 3.04 Å

PDB Description: crystal structure of antibody against schizophyllan
PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d6ev1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ev1b2 b.1.1.2 (B:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnr

SCOPe Domain Coordinates for d6ev1b2:

Click to download the PDB-style file with coordinates for d6ev1b2.
(The format of our PDB-style files is described here.)

Timeline for d6ev1b2:

  • d6ev1b2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-27