SCOPe 2.08: Domain d5yshl_: 5ysh L:

Lineage for d5yshl_ (5ysh L:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)

6. Protein automated matches [357833] (1 species)
   not a true protein

7. Species Klebsiella oxytoca [TaxId:571] [357834] (3 PDB entries)

8. Domain d5yshl_: 5ysh L: [357937]
   Other proteins in same PDB: d5ysha_, d5yshb_, d5yshd_, d5yshe_, d5yshg_, d5yshh1, d5yshh2, d5yshj_, d5yshk_
   automated match to d3aujg_
   complexed with 5ad, b12, ca, k, pgo; mutant

Details for d5yshl_

PDB Entry: 5ysh, 1.9 Å

PDB Description: diol dehydratase - alpha/t172a mutant complexed with adocbl, aerobically-prepared crystal

PDB Compounds: (L:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d5yshl_:

Sequence; same for both SEQRES and ATOM records:

>d5yshl_ a.23.2.1 (L:) automated matches {Klebsiella oxytoca [TaxId: 571]}
arvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakdag
rdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafvr
eaatlyverkklkgdd

Timeline for d5yshl_:

• d5yshl_ first appeared in SCOPe 2.07