Lineage for d5yshe_ (5ysh E:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459598Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2459777Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2459778Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2459779Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2459780Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 3057860Domain d5yshe_: 5ysh E: [357922]
    Other proteins in same PDB: d5ysha_, d5yshc_, d5yshd_, d5yshf_, d5yshg_, d5yshh2, d5yshi_, d5yshj_, d5yshl_
    automated match to d3auje_
    complexed with 5ad, b12, ca, k, pgo; mutant

Details for d5yshe_

PDB Entry: 5ysh (more details), 1.9 Å

PDB Description: diol dehydratase - alpha/t172a mutant complexed with adocbl, aerobically-prepared crystal
PDB Compounds: (E:) diol dehydrase beta subunit

SCOPe Domain Sequences for d5yshe_:

Sequence, based on SEQRES records: (download)

>d5yshe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
fltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvir
cfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyr
qigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

Sequence, based on observed residues (ATOM records): (download)

>d5yshe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
fltevgearqtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvirc
fkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrq
igknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva

SCOPe Domain Coordinates for d5yshe_:

Click to download the PDB-style file with coordinates for d5yshe_.
(The format of our PDB-style files is described here.)

Timeline for d5yshe_:

  • d5yshe_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20