Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) |
Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) contains additional structures in the C-terminal extension |
Protein Diol dehydratase, beta subunit [52970] (2 species) |
Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries) |
Domain d5yshh1: 5ysh H:46-223 [357844] Other proteins in same PDB: d5ysha_, d5yshc_, d5yshd_, d5yshf_, d5yshg_, d5yshh2, d5yshi_, d5yshj_, d5yshl_ automated match to d3auje_ complexed with 5ad, b12, ca, k, pgo; mutant |
PDB Entry: 5ysh (more details), 1.9 Å
SCOPe Domain Sequences for d5yshh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yshh1 c.51.3.1 (H:46-223) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]} gfltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvi rcfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltlety rqigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrva
Timeline for d5yshh1: