Lineage for d5yshk_ (5ysh K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882071Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2882072Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 2882073Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 2882074Species Klebsiella oxytoca [TaxId:571] [52971] (11 PDB entries)
  8. 2882102Domain d5yshk_: 5ysh K: [357849]
    Other proteins in same PDB: d5ysha_, d5yshc_, d5yshd_, d5yshf_, d5yshg_, d5yshh2, d5yshi_, d5yshj_, d5yshl_
    automated match to d3auje_
    complexed with 5ad, b12, ca, k, pgo; mutant

Details for d5yshk_

PDB Entry: 5ysh (more details), 1.9 Å

PDB Description: diol dehydratase - alpha/t172a mutant complexed with adocbl, aerobically-prepared crystal
PDB Compounds: (K:) diol dehydrase beta subunit

SCOPe Domain Sequences for d5yshk_:

Sequence, based on SEQRES records: (download)

>d5yshk_ c.51.3.1 (K:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
tevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvircf
kssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyrqi
gknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv

Sequence, based on observed residues (ATOM records): (download)

>d5yshk_ c.51.3.1 (K:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
tevgearqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvircfkss
dvafvavegnrlsgsgisigiqskgttvihpplsnlelfpqaplltletyrqigknaary
akrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv

SCOPe Domain Coordinates for d5yshk_:

Click to download the PDB-style file with coordinates for d5yshk_.
(The format of our PDB-style files is described here.)

Timeline for d5yshk_: