Lineage for d5yshl_ (5ysh L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312634Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2312635Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2312659Protein automated matches [357833] (1 species)
    not a true protein
  7. 2312660Species Klebsiella oxytoca [TaxId:571] [357834] (3 PDB entries)
  8. 2312672Domain d5yshl_: 5ysh L: [357937]
    Other proteins in same PDB: d5ysha_, d5yshb_, d5yshd_, d5yshe_, d5yshg_, d5yshh1, d5yshh2, d5yshj_, d5yshk_
    automated match to d3aujg_
    complexed with 5ad, b12, ca, k, pgo; mutant

Details for d5yshl_

PDB Entry: 5ysh (more details), 1.9 Å

PDB Description: diol dehydratase - alpha/t172a mutant complexed with adocbl, aerobically-prepared crystal
PDB Compounds: (L:) diol dehydrase gamma subunit

SCOPe Domain Sequences for d5yshl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yshl_ a.23.2.1 (L:) automated matches {Klebsiella oxytoca [TaxId: 571]}
arvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakdag
rdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafvr
eaatlyverkklkgdd

SCOPe Domain Coordinates for d5yshl_:

Click to download the PDB-style file with coordinates for d5yshl_.
(The format of our PDB-style files is described here.)

Timeline for d5yshl_: