Lineage for d5ysha_ (5ysh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425286Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2425331Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 proteins)
    automatically mapped to Pfam PF02286
  6. 2425332Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2425333Species Klebsiella oxytoca [TaxId:571] [51712] (10 PDB entries)
  8. 3057777Domain d5ysha_: 5ysh A: [357839]
    Other proteins in same PDB: d5yshb_, d5yshc_, d5yshe_, d5yshf_, d5yshh1, d5yshh2, d5yshi_, d5yshk_, d5yshl_
    automated match to d1iwpa_
    complexed with 5ad, b12, ca, k, pgo; mutant

Details for d5ysha_

PDB Entry: 5ysh (more details), 1.9 Å

PDB Description: diol dehydratase - alpha/t172a mutant complexed with adocbl, aerobically-prepared crystal
PDB Compounds: (A:) diol dehydrase alpha subunit

SCOPe Domain Sequences for d5ysha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysha_ c.1.19.3 (A:) Diol dehydratase, alpha subunit {Klebsiella oxytoca [TaxId: 571]}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqetavavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOPe Domain Coordinates for d5ysha_:

Click to download the PDB-style file with coordinates for d5ysha_.
(The format of our PDB-style files is described here.)

Timeline for d5ysha_:

  • d5ysha_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20