Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries) |
Domain d5xdxb2: 5xdx B:91-227 [348523] Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ automated match to d1v54b1 complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5xdx (more details), 1.99 Å
SCOPe Domain Sequences for d5xdxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdxb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d5xdxb2:
View in 3D Domains from other chains: (mouse over for more information) d5xdxa_, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ |