| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries) |
| Domain d5xdxz_: 5xdx Z: [348502] Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_ automated match to d1v54m_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5xdx (more details), 1.99 Å
SCOPe Domain Sequences for d5xdxz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdxz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d5xdxz_:
View in 3DDomains from other chains: (mouse over for more information) d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_ |