SCOPe 2.07: Domain d5xdxb2: 5xdx B:91-227

Lineage for d5xdxb2 (5xdx B:91-227)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries)

8. Domain d5xdxb2: 5xdx B:91-227 [348523]
   Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_
   automated match to d1v54b1
   complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxb2

PDB Entry: 5xdx, 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5xdxb2:

Sequence; same for both SEQRES and ATOM records:

>d5xdxb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d5xdxb2:

• d5xdxb2 is new in SCOPe 2.07-stable
  
• d5xdxb2 appears in the current release, SCOPe 2.08