Lineage for d5xdxs_ (5xdx S:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036679Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 3036778Protein automated matches [254652] (1 species)
    not a true protein
  7. 3036779Species Cow (Bos taurus) [TaxId:9913] [255694] (7 PDB entries)
  8. 3036791Domain d5xdxs_: 5xdx S: [348509]
    Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxt_, d5xdxu_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_
    automated match to d3ag3f_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxs_

PDB Entry: 5xdx (more details), 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution
PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5xdxs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdxs_ g.41.5.3 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvph

SCOPe Domain Coordinates for d5xdxs_:

Click to download the PDB-style file with coordinates for d5xdxs_.
(The format of our PDB-style files is described here.)

Timeline for d5xdxs_: