![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein Cytochrome c oxidase subunit h [47696] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries) |
![]() | Domain d5xdxu_: 5xdx U: [348775] Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ automated match to d1v54h_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5xdx (more details), 1.99 Å
SCOPe Domain Sequences for d5xdxu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xdxu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5xdxu_:
![]() Domains from other chains: (mouse over for more information) d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxh_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_ |