Lineage for d5xdxu_ (5xdx U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323609Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2323610Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2323611Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2323612Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2323613Species Cow (Bos taurus) [TaxId:9913] [47697] (24 PDB entries)
  8. 3048713Domain d5xdxu_: 5xdx U: [348775]
    Other proteins in same PDB: d5xdxa_, d5xdxb1, d5xdxb2, d5xdxc_, d5xdxd_, d5xdxe_, d5xdxf_, d5xdxg_, d5xdxi_, d5xdxj_, d5xdxk_, d5xdxl_, d5xdxm_, d5xdxn_, d5xdxo1, d5xdxo2, d5xdxp_, d5xdxq_, d5xdxr_, d5xdxs_, d5xdxt_, d5xdxv_, d5xdxw_, d5xdxx_, d5xdxy_, d5xdxz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5xdxu_

PDB Entry: 5xdx (more details), 1.99 Å

PDB Description: bovine heart cytochrome c oxidase in the reduced state with ph 7.3 at 1.99 angstrom resolution
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5xdxu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdxu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5xdxu_:

Click to download the PDB-style file with coordinates for d5xdxu_.
(The format of our PDB-style files is described here.)

Timeline for d5xdxu_:

  • d5xdxu_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07