Lineage for d6blxa2 (6blx A:85-182)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021990Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2022056Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2299693Domain d6blxa2: 6blx A:85-182 [342994]
    Other proteins in same PDB: d6blxa1
    automated match to d1f3ja1
    complexed with edo, fmt, nag

Details for d6blxa2

PDB Entry: 6blx (more details), 2.32 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8g9e
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6blxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blxa2 b.1.1.2 (A:85-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwep

SCOPe Domain Coordinates for d6blxa2:

Click to download the PDB-style file with coordinates for d6blxa2.
(The format of our PDB-style files is described here.)

Timeline for d6blxa2:

  • d6blxa2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21