Lineage for d6blxa1 (6blx A:1-84)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2507143Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2507214Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88817] (4 PDB entries)
  8. 2507216Domain d6blxa1: 6blx A:1-84 [342993]
    Other proteins in same PDB: d6blxa2
    automated match to d1f3ja2
    complexed with edo, fmt, nag

Details for d6blxa1

PDB Entry: 6blx (more details), 2.32 Å

PDB Description: crystal structure of iag7 in complex with insulin mimotope p8g9e
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6blxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blxa1 d.19.1.1 (A:1-84) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpa

SCOPe Domain Coordinates for d6blxa1:

Click to download the PDB-style file with coordinates for d6blxa1.
(The format of our PDB-style files is described here.)

Timeline for d6blxa1: