Lineage for d5v2ci_ (5v2c I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026719Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 3026727Domain d5v2ci_: 5v2c I: [338777]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d4ub8i_
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pe8, pg4, pge, pho, pl9, sqd

Details for d5v2ci_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5v2ci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2ci_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d5v2ci_:

Click to download the PDB-style file with coordinates for d5v2ci_.
(The format of our PDB-style files is described here.)

Timeline for d5v2ci_: