Lineage for d5v2cz_ (5v2c Z:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024237Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 3024238Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 3024239Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 3024250Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 3024261Domain d5v2cz_: 5v2c Z: [338813]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_
    automated match to d4pj0z_
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pe8, pg4, pge, pho, pl9, sqd

Details for d5v2cz_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5v2cz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2cz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5v2cz_:

Click to download the PDB-style file with coordinates for d5v2cz_.
(The format of our PDB-style files is described here.)

Timeline for d5v2cz_: