| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
| Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
| Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries) |
| Domain d5v2ci_: 5v2c I: [338777] Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_ automated match to d4ub8i_ complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd |
PDB Entry: 5v2c (more details), 1.9 Å
SCOPe Domain Sequences for d5v2ci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2ci_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle
Timeline for d5v2ci_: