SCOPe 2.08: Domain d5v2ct_: 5v2c T:

Lineage for d5v2ct_ (5v2c T:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)

8. Domain d5v2ct_: 5v2c T: [338713]
   Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
   automated match to d3bz2t_
   complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pe8, pg4, pge, pho, pl9, sqd

Details for d5v2ct_

PDB Entry: 5v2c, 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex

PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5v2ct_:

Sequence; same for both SEQRES and ATOM records:

>d5v2ct_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Timeline for d5v2ct_:

• d5v2ct_ first appeared in SCOPe 2.06
  
• d5v2ct_ appears in SCOPe 2.07