SCOPe 2.08: Domain d5v2cf_: 5v2c F:

Lineage for d5v2cf_ (5v2c F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)

8. Domain d5v2cf_: 5v2c F: [338733]
   Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
   automated match to d2axtf1
   complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pe8, pg4, pge, pho, pl9, sqd

Details for d5v2cf_

PDB Entry: 5v2c, 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5v2cf_:

Sequence; same for both SEQRES and ATOM records:

>d5v2cf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5v2cf_:

• d5v2cf_ first appeared in SCOPe 2.06
  
• d5v2cf_ appears in SCOPe 2.07